Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
121 IPI00002745.1 Cathepsin Z precursor Cyto(G1); Mito(G1); ER(GO) 1.12E+00 (NVDGVNYASITR;RGQTCYR;YNLAIEEHCTFGDPIV) 4.59E-01 (DQECDKFNQCGTCNEFK;NVDGVNYASITR;FNQCGTCNEFK;VGDYGSLSGR;YNLAIEEHCTFGDPIV) 1.77E-01 (NVDGVNYASITR;YNLAIEEHCTFGDPIV) - - 2.06E-01 (NVDGVNYASITR;YNLAIEEHCTFGDPIV) 1 IPI00002745.1
122 IPI00002790.3 Isoform 1 of Sel-1 homolog precursor ER(SP) 1.03E-01 (LGVVYFLQYIR;LVANHVASDISLTGGSVVQR;VSYALLFGDYLPQNIQAAR;VVAGQIFLDSEESELESSIQEEEDSLK;GDVQAQVGLGQLHLHGGR) - - 3.83E-01 (AADMGNPVGQSGLGMAYLYGR;AFDYFNLAANAGNSHAMAFLGK;LVANHVASDISLTGGSVVQR;GDVQAQVGLGQLHLHGGR;GQTALGFLYASGLGVNSSQAK;LASEQQHSAQAMFNLGYMHEK;LGDYHFYGFGTDVDYETAFIHYR;LGVVYFLQYIR;PAPPQQEGPPEQQPPQ;SQEGESVT 4.66E-01 (AADMGNPVGQSGLGMAYLYGR;AFDYFNLAANAGNSHAMAFLGK;GDVQAQVGLGQLHLHGGR;GQTALGFLYASGLGVNSSQAK;LGDYHFYGFGTDVDYETAFIHYR;LGVVYFLQYIR;LVANHVASDISLTGGSVVQR;PAPPQQEGPPEQQPPQ;SQEGESVTEDISFLESPNPENK;SQEGESV - 1 IPI00002790.3
123 IPI00002857.2 mitogen-activated protein kinase 14 isoform 2 Cyto(G2,GO); Nucl(GO) - 7.94E-02 (HENVIGLLDVFTPAR;LTDDHVQFLIYQILR;MNFANVFIGANPLAVDLLEKMLVLDSDK) - - - - 2 IPI00002857.2, IPI00221141.3
124 IPI00002922.5 F-box-like/WD repeat protein TBL1XR1 Nucl(G1,GO,HPA) - - - - - 2.92E-01 (HQEPVYSVAFSPDGR;LAQQQAAAAAAAAAAASQQGSAK;TTIIWDAHTGEAK;VGASASDGSVCVLDLR;GHESEVFICAWNPVSDLLASGSGDSTAR;IWNLSENSTSGSTQLVLR) 1 IPI00002922.5
125 IPI00002966.1 Heat shock 70 kDa protein 4 Cyto(G1,GO,HPA); Nucl(GO,HPA) - 4.18E-01 (EDIYAVEIVGGATR;ELSTTLNADEAVTR;FLEMCNDLLAR;IKELTSTCSPIISK;IKELTSTCSPIISKPK;KPVVDCVVSVPCFYTDAER;MQVDQEEPHVEEQQQQTPAENK;NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK;NKEDQYDHLDAADMTK;QDLPALEEKPR;SNLAYDIVQ - - 1.38E-02 (VKTSTVDLPIENQLLWQIDR;EFSITDVVPYPISLR) - 1 IPI00002966.1
126 IPI00003004.1 Mitochondrial glutamate carrier 1 Mito(G1,GO,MitoP2,HPA); Nucl(GO,HPA) 2.32E-01 (DVPFSVVYFPLFANLNQLGR;GAAVNLTLVTPEK;LAANDFFR;LINGGIAGLIGVTCVFPIDLAK) - 6.78E-01 (LINGGIAGLIGVTCVFPIDLAK;GAAVNLTLVTPEK;LAANDFFR;DVPFSVVYFPLFANLNQLGR;GVNEDTYSGILDCAR) - 1.09E-01 (DVPFSVVYFPLFANLNQLGR;GAAVNLTLVTPEK) - 1 IPI00003004.1
127 IPI00003021.1 Sodium/potassium-transporting ATPase alpha-2 chain precursor PM(G2,SP,GO); Cyto(GO) - 2.85E-02 (GVGIISEGNETVEDIAAR;VDNSSLTGESEPQTR;DTAGDASESALLK) - 1.42E-02 (GVGIISEGNETVEDIAAR;VDNSSLTGESEPQTR;DTAGDASESALLK) - - 2 IPI00640401.1, IPI00003021.1
128 IPI00003031.2 CDNA: FLJ23469 fis, clone HSI11914 Cyto(SP,GO); Nucl(SP,GO) - 4.59E-01 (EPAPDSGLLGLFQGQNSLLH;LIKEPAPDSGLLGLFQGQNSLLH;GLQVHVVVDACSSR;HNIAYFPQIVSVAAR;LLEVPVMLTEQYPQGLGPTVPELGTEGLRPLAK;VLPGSSVLFLCDMQEK) 1.72E+00 (EPAPDSGLLGLFQGQNSLLH;LIKEPAPDSGLLGLFQGQNSLLH;HNIAYFPQIVSVAAR;QSGAFLSTSEGLILQLVGDAVHPQFK;GLQVHVVVDACSSR) - - 7.33E-01 (EPAPDSGLLGLFQGQNSLLH;LIKEPAPDSGLLGLFQGQNSLLH;HNIAYFPQIVSVAAR;QSGAFLSTSEGLILQLVGDAVHPQFK) 2 IPI00003031.2, IPI00551022.2
129 IPI00003091.1 Isoform 1 of Protein phosphatase 1 regulatory subunit 3A Nucl(G1) - - - - - 3.02E-02 (ISVAGIGASNR;AILESTESLLGSTSIKGIIR) 1 IPI00003091.1
130 IPI00003168.1 Phosphoribosyl pyrophosphate synthetase-associated protein 2 Cyto(G2) - 3.53E-02 (PPITVVGDVGGR;GKDVFIIQTVSK;IAIIVDDIIDDVDSFLAAAETLK;IFVMATHGLLSSDAPR) - - - - 1 IPI00003168.1
131 IPI00003217.3 Proteasome subunit beta type 7 precursor Cyto(SP); Nucl(SP) - 1.15E+00 (DGIVLGADTR;IHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGR;YQGYIGAALVLGGVDVTGPHLYSIYPHGSTDK;FRPDMEEEEAK;LDFLRPYTVPNK;LDFLRPYTVPNKK;LPYVTMGSGSLAAMAVFEDK;ITPLEIEVLEETVQTMDTS;NLVSEAIAAGIFNDLGSGSNIDLCVI - - 6.14E-02 (LPYVTMGSGSLAAMAVFEDK;FRPDMEEEEAK) 1.09E-01 (LDFLRPYTVPNK;YQGYIGAALVLGGVDVTGPHLYSIYPHGSTDK) 1 IPI00003217.3
132 IPI00003269.1 hypothetical protein LOC345651 PM(G1) 2.39E+00 (SYELPDGQVITIGNER;DLTDYLMK;DLTDYLMKILTER;VAPDEHPILLTEAPLNPK;VAPDEHPILLTEAPLNPKINR;IWYHTFYNELR) 7.17E-02 (IIAPPERKYSVWIGGSILASLSTFQQMWISK;SYELPDGQVITIGNER;DLTDYLMK;IKIIAPPER;VAPDEHPILLTEAPLNPK;TTGIVMDSGDGVTHIVPIYEGYALPHAILR) - 2.21E-01 (SYELPDGQVITIGNER;DLTDYLMK;TTGIVMDSGDGVTHIVPIYEGYALPHAILR;VAPDEHPILLTEAPLNPK) 1.45E-01 (SYELPDGQVITIGNER;DLTDYLMK;TTGIVMDSGDGVTHIVPIYEGYALPHAILR;VAPDEHPILLTEAPLNPK) 2.84E-01 (SYELPDGQVITIGNER;DLTDYLMK;VAPDEHPILLTEAPLNPKINR;VAPDEHPILLTEAPLNPK) 1 IPI00003269.1
133 IPI00003309.3 DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide Nucl(SP,GO,HPA); Cyto(HPA) - 2.29E-01 (LQGDANNLHGFEVDSR;LVIASTLYEDGTLDDGEYNPTDDRPSR) - - - - 1 IPI00003309.3
134 IPI00003326.4 ADP-ribosylation factor-like protein 2 Cyto(G1,SP); Mito(SP,GO); Nucl(SP,GO) - 1.61E-01 (FNGEDIDTISPTLGFNIK;LAGATLLIFANK;QDLPGALSSNAIR;ELQSLLVEER) - - - - 1 IPI00003326.4
135 IPI00003327.1 ADP-ribosylation factor-like protein 3 Cyto(G1,SP,GO,HPA); PM(HPA); Nucl(SP,GO,HPA) - 2.75E-01 (LSCVPVLIFANK;NYFENTDILIYVIDSADR;NYFENTDILIYVIDSADRK;QDLLTAAPASEIAEGLNLHTIR;RFEETGQELAELLEEEKLSCVPVLIFANK;FEETGQELAELLEEEKLSCVPVLIFANK;ILLLGLDNAGK) - - - - 1 IPI00003327.1
136 IPI00003328.1 Isoform Alpha of GTP-binding protein ARD-1 Cyto(G2) 2.28E-02 (DAIILIFANK;KNFALLELLER) - - - - - 3 IPI00220244.1, IPI00018593.1, IPI00003328.1
137 IPI00003348.2 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta 2 Cyto(SP); PM(GO) 3.20E-01 (ACGDSTLTQITAGLDPVGR;LIIWDSYTTNK;TFVSGACDASIK) 1.20E-01 (LIIWDSYTTNK;ACGDSTLTQITAGLDPVGR;ELPGHTGYLSCCR;KACGDSTLTQITAGLDPVGR;TFVSGACDASIK) - - - - 5 IPI00797719.1, IPI00790896.1, IPI00790302.1, IPI00790284.1, IPI00003348.2
138 IPI00003362.2 Hypothetical protein ER(SP,GO); Nucl(GO); PM(GO) 2.89E+00 (IINEPTAAAIAYGLDK;DNHLLGTFDLTGIPPAPR;ELEEIVQPIISK;IINEPTAAAIAYGLDKR;ITPSYVAFTPEGER;KSDIDEIVLVGGSTR;NELESYAYSLK;NQLTSNPENTVFDAK;SDIDEIVLVGGSTR;SQIFSTASDNQPTVTIK;TFAPEEISAMVLTK;TKPYIQVDIGGGQTK; 4.24E-01 (VEIIANDQGNR;DNHLLGTFDLTGIPPAPR;EFFNGKEPSR;ELEEIVQPIISK;IEWLESHQDADIEDFK;KKELEEIVQPIISK;KSDIDEIVLVGGSTR;NQLTSNPENTVFDAK;SQIFSTASDNQPTVTIK;TFAPEEISAMVLTK;TKPYIQVDIGGGQTK;VTHAVVTVPAYFNDAQR;AKFE 1.03E-01 (NQLTSNPENTVFDAK;TKPYIQVDIGGGQTK;VTHAVVTVPAYFNDAQR;IINEPTAAAIAYGLDK;IINEPTAAAIAYGLDKR;ITPSYVAFTPEGER) 2.92E+01 (IINEPTAAAIAYGLDK;AKFEELNMDLFR;AVEEKIEWLESHQDADIEDFK;DAGTIAGLNVMR;DNHLLGTFDLTGIPPAPR;SQIFSTASDNQPTVTIK;ELEEIVQPIISK;VTHAVVTVPAYFNDAQR;FEELNMDLFR;IEIESFFEGEDFSETLTR;IEWLESHQDADIEDFK;IEWLESHQDA 1.88E+01 (IINEPTAAAIAYGLDK;AKFEELNMDLFR;DAGTIAGLNVMR;DNHLLGTFDLTGIPPAPR;ELEEIVQPIISK;FEELNMDLFR;GVPQIEVTFEIDVNGILR;IEWLESHQDADIEDFK;IEWLESHQDADIEDFKAK;IINEPTAAAIAYGLDKR;ITPSYVAFTPEGER;KKELEEIVQPIISK;K 3.60E+00 (IINEPTAAAIAYGLDK;DNHLLGTFDLTGIPPAPR;ELEEIVQPIISK;IEWLESHQDADIEDFK;KKELEEIVQPIISK;KSDIDEIVLVGGSTR;KSQIFSTASDNQPTVTIK;NQLTSNPENTVFDAK;SQIFSTASDNQPTVTIK;TKPYIQVDIGGGQTK;VTHAVVTVPAYFNDAQR;GVPQIE 1 IPI00003362.2
139 IPI00003377.1 Isoform 1 of Splicing factor, arginine/serine-rich 7 Nucl(SP,GO,HPA) - 1.01E-01 (VYVGNLGTGAGK;NPPGFAFVEFEDPR;NPPGFAFVEFEDPRDAEDAVR) 6.75E-02 (AFSYYGPLR;NPPGFAFVEFEDPR;NPPGFAFVEFEDPRDAEDAVR) - - 1.97E+00 (NPPGFAFVEFEDPR;VYVGNLGTGAGK;AFSYYGPLR;NPPGFAFVEFEDPRDAEDAVR) 2 IPI00215907.1, IPI00003377.1
140 IPI00003384.1 Isoform 1 of Cadherin EGF LAG seven-pass G-type receptor 1 precursor PM(SP,GO) 9.40E-03 (ELLDVGRDGRLAGR;GSVGNAVRHCSGEK) - - - - - 1 IPI00003384.1
141 IPI00003389.1 Mitochondrial ornithine transporter 1 Mito(SP,GO,MitoP2) 7.05E-01 (AFPANGALFLAYEYSR;DGPLGFYHGLSSTLLR;EVPGYFFFFGGYELSR;NEGITALYSGLKPTMIR) - 1.92E+00 (DGPLGFYHGLSSTLLR;LSDLQNAAAGSFASAFAALVLCPTELVK;SQNTVWSVIK;AFPANGALFLAYEYSR;EVPGYFFFFGGYELSR;KDGPLGFYHGLSSTLLR) 2.63E-01 (DGPLGFYHGLSSTLLR;EVPGYFFFFGGYELSR;KDGPLGFYHGLSSTLLR;LQTMYEMETSGK;NEGITALYSGLKPTMIR;SQNTVWSVIK;KLMMNQLEAY;AFPANGALFLAYEYSR;SQNTVWSVIKSILRK) 3.48E-01 (DGPLGFYHGLSSTLLR;EVPGYFFFFGGYELSR;LQTMYEMETSGK;NEGITALYSGLKPTMIR;KLMMNQLEAY;MQTFPDLYR;AFPANGALFLAYEYSR;IQVLSMSGK) 7.73E-02 (DGPLGFYHGLSSTLLR;LSDLQNAAAGSFASAFAALVLCPTELVK;AFPANGALFLAYEYSR) 2 IPI00003389.1, IPI00792886.1
142 IPI00003438.2 DnaJ homolog subfamily C member 8 Nucl(G1,GO) - - - - - 1.29E-01 (EGKPTIVEEDDPELFK;LTRPGSSYFNLNPFEVLQIDPEVTDEEIK) 1 IPI00003438.2
143 IPI00003443.3 Isoform 1 of Gamma-interferon-inducible protein Ifi-16 Nucl(SP,GO,HPA); Cyto(GO,HPA) - - - 1.45E-02 (EVDATSPAPSTSSTVK;EVMVLNATESFVYEPK) - 7.39E-02 (EVDATSPAPSTSSTVK;NGFLEVYPFTLVADVNADR;GEFTYYEIQDNTGK) 2 IPI00003443.3, IPI00217475.2
144 IPI00003479.2 Mitogen-activated protein kinase 1 Nucl(SP,GO); Cyto(GO) - 6.69E-02 (ISPFEHQTYCQR;VADPDHDHTGFLTEYVATR;NYLLSLPHK;HYLDQLNHILGILGSPSQEDLNCIINLK;IEVEQALAHPYLEQYYDPSDEPIAEAPFK) - - 8.70E-02 (HENIIGINDIIR;VADPDHDHTGFLTEYVATR;FDMELDDLPK) - 1 IPI00003479.2
145 IPI00003480.2 Cytochrome P450 2A13 ER(SP,GO) 9.76E-01 (DFIDSFLIR;EALVDQAEEFSGR;SDAFVPFSIGK;TVSNVISSIVFGDR;FSIATLR;HVGFATIPR;IQEEAGFLIDALR) - - 1.41E+00 (DFIDSFLIR;NYTMSFLPR;DFFLPK;EALVDQAEEFSGR;HVGFATIPR;KSDAFVPFSIGK;SDAFVPFSIGK;TVSNVISSIVFGDR;YGFLLLMK;NPNTEFYLK;GKLPPGPTPLPFIGNYLQLNTEQMYNSLMK;LPPGPTPLPFIGNYLQLNTEQMYNSLMK;MQEEEKNPNTEFYLK;RFSI 1.62E+00 (DFIDSFLIR;NYTMSFLPR;EALVDQAEEFSGR;HVGFATIPR;KSDAFVPFSIGK;SDAFVPFSIGK;TVSNVISSIVFGDR;YGFLLLMK;GKLPPGPTPLPFIGNYLQLNTEQMYNSLMK;LPPGPTPLPFIGNYLQLNTEQMYNSLMK;MQEEEKNPNTEFYLK;FSIATLR;RFSIATLR;YGPV 1.08E-01 (EALVDQAEEFSGR;TVSNVISSIVFGDR;HVGFATIPR;IQEEAGFLIDALR) 1 IPI00003480.2
146 IPI00003482.1 2,4-dienoyl-CoA reductase, mitochondrial precursor Mito(SP,GO,MitoP2); Cyto(GO); Nucl(GO); PM(GO) 5.30E+00 (DPDMVQNTVSELIK;VAGHPNIVINNAAGNFISPTER;EQWDTIEELIR;FDGGEEVLISGEFNDLR;FDGGEEVLISGEFNDLRK;FNVIQPGPIK;GAAFLSITTIYAETGSGFVVPSASAK;GMTTLLSSLGAQCVIASR;VAFITGGGTGLGK;LDPTGTFEK;FFSPLQK) 4.30E-01 (EQWDTIEELIR;FDGGEEVLISGEFNDLR;FDGGEEVLISGEFNDLRK;GMTTLLSSLGAQCVIASR;VAFITGGGTGLGK;VAGHPNIVINNAAGNFISPTER;FNVIQPGPIK;LDPTGTFEK;DPDMVQNTVSELIK;GAAFLSITTIYAETGSGFVVPSASAK) 1.69E+01 (EQWDTIEELIR;FDGGEEVLISGEFNDLR;FDGGEEVLISGEFNDLRK;GAAFLSITTIYAETGSGFVVPSASAK;GMTTLLSSLGAQCVIASR;TITDIVLNGTAFVTLEIGK;VAFITGGGTGLGK;VAGHPNIVINNAAGNFISPTER;VHAIQCDVRDPDMVQNTVSELIK;DPDMVQNTVSELIK 1.49E+00 (DPDMVQNTVSELIK;EQWDTIEELIR;FDGGEEVLISGEFNDLR;FDGGEEVLISGEFNDLRK;FNVIQPGPIK;GAAFLSITTIYAETGSGFVVPSASAK;VAFITGGGTGLGK;VAGHPNIVINNAAGNFISPTER;LDPTGTFEK;AMLPPNSFQGK;FFSPLQK) 4.10E-01 (DPDMVQNTVSELIK;FDGGEEVLISGEFNDLR;FDGGEEVLISGEFNDLRK;FNVIQPGPIK;GAAFLSITTIYAETGSGFVVPSASAK;VAFITGGGTGLGK;VAGHPNIVINNAAGNFISPTER;FFSPLQK) 6.05E+00 (VAGHPNIVINNAAGNFISPTER;EQWDTIEELIR;FDGGEEVLISGEFNDLR;FDGGEEVLISGEFNDLRK;GAAFLSITTIYAETGSGFVVPSASAK;GMTTLLSSLGAQCVIASR;TITDIVLNGTAFVTLEIGK;VAFITGGGTGLGK;FNVIQPGPIK;LGTVEELANLAAFLCSDYASWINGAVI 1 IPI00003482.1
147 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component Nucl(SP,GO,HPA); Cyto(GO,HPA) - 2.07E-02 (VADPVVTFCETVVETSSLK;VLSGTIHAGQPVK;SYLFNIMDTPGHVNFSDEVTAGLR) - - - 1.23E+00 (AFIPAIDSFGFETDLR;GLAEDIENEVVQITWNR;IAVEPVNPSELPK;ILAQVVGDVDTSLPR;ILDAVVAQEPLHR;IYADTFGDINYQEFAK;LGEFFQTK;RLWGDIYFNPK;RYDQDLCYTDILFTEQER;SIVIRPLEPQPAPHLAR;TCFVDCLIEQTHPEIR;VADPVVTFCETVVETSSLK 1 IPI00003519.1
148 IPI00003527.4 Ezrin-radixin-moesin-binding phosphoprotein 50 Nucl(G2,GO); Cyto(GO,HPA); PM(GO,HPA) - 4.23E-02 (LLVVDPETDEQLQK;LVEVNGENVEK;SVDPDSPAEASGLR) - - 8.03E-02 (LLVVDPETDEQLQK;ETHQQVVSR;SVDPDSPAEASGLR) - 1 IPI00003527.4
149 IPI00003565.1 26S proteasome non-ATPase regulatory subunit 10 Cyto(SP,GO,HPA); Nucl(SP,GO) - 1.62E-01 (ASTNIQDTEGNTPLHLACDEER;ASTNIQDTEGNTPLHLACDEERVEEAK;LEELKESILADK;GAQVNAVNQNGCTPLHYAASK) - - - - 2 IPI00003565.1, IPI00027699.2
150 IPI00003588.1 Eukaryotic translation elongation factor 1 epsilon-1 Cyto(G1,SP,GO,HPA); Nucl(SP,GO,HPA) - 3.34E-01 (DLNSYLEDK;EYLLGSTAEEK;QHLSSVVFIK;QIPVLQTNNGPSLTGLTTIAAHLVK;WFCHIQHYPGIR) - - - - 1 IPI00003588.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home