Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
151 IPI00003627.1 Isoform 1 of Actin-like protein 6A Nucl(SP); PM(GO) - - - - - 9.80E-01 (QGGPTYYIDTNALR;TAVLTAFANGR;LKIPEGLFDPSNVK;STGLILDSGATHTTAIPVHDGYVLQQGIVK) 2 IPI00003627.1, IPI00216622.1
152 IPI00003704.4 Isoform 1 of RNA-binding protein 4 Cyto(SP); Nucl(SP) - - - - - 1.74E-01 (FEEYGPVIECDIVK;LHGVNINVEASK;NYGFVHIEDK;HLLPTSGAAATAAAAAAAAAAVTAASTSYYGR;VADLTEQYNEQYGAVR;ATAPVPTVGEGYGYGHESELSQASAAAR) 1 IPI00003704.4
153 IPI00003766.4 ETHE1 protein, mitochondrial precursor Mito(SP,GO,MitoP2,HPA); Cyto(SP,GO); Nucl(SP,HPA) - 1.99E-01 (IFTLPGDCLIYPAHDYHGFTVSTVEEER;EAVLIDPVLETAPR;LLYAVNTHCHADHITGSGLLR;LTLSCEEFVK) 9.59E-01 (IFTLPGDCLIYPAHDYHGFTVSTVEEER;EAVLIDPVLETAPR;LLYAVNTHCHADHITGSGLLR;LSGAQADLHIEDGDSIR;SLLPGCQSVISR;LTLSCEEFVK) - - - 1 IPI00003766.4
154 IPI00003783.1 Dual specificity mitogen-activated protein kinase kinase 2 Cyto(G1,GO) - 2.07E-01 (ELEAIFGRPVVDGEEGEPHSISPR;LIHLEIKPAIR;LPNGVFTPDFQEFVNK;KLIHLEIKPAIR;YPIPPPDAK;DVKPSNILVNSR;VGELKDDDFER;KLEELELDEQQKK;ISELGAGNGGVVTK) - - - - 1 IPI00003783.1
155 IPI00003802.1 Alpha-mannosidase 2 ER(G2) 5.17E-02 (FLSSSLYTALTEAR;LLAENNEIISNIR;TIQSKVGNGHSNEAALILHR) 8.82E-03 (INKFLSSSLYTALTEAR;NIIRLSAEPR) - 3.12E-02 (FLSSSLYTALTEAR;ILESASSNSHLADYVLYK;IQFGTLSDFFDALDK;LLAENNEIISNIR) 7.36E-02 (FLSSSLYTALTEAR;IQFGTLSDFFDALDK;LLAENNEIISNIR;NLGLFQHHDAITGTAK;ILESASSNSHLADYVLYK;DSVINLSESVEDGPK;TQYIFNNMVLK) - 1 IPI00003802.1
156 IPI00003807.7 Lysosomal acid phosphatase precursor Cyto(G2) - - - - 1.02E-01 (FLFGIYQQAEK;LQGGVLLAQIR) - 1 IPI00003807.7
157 IPI00003814.1 Isoform 1 of Dual specificity mitogen-activated protein kinase kinase 6 Cyto(G2,GO); Nucl(GO) - 2.37E-02 (EAFEQPQTSSTPPRDLDSK;EAFEQPQTSSTPPR) - - - - 2 IPI00003814.1, IPI00425919.2
158 IPI00003815.2 Rho GDP-dissociation inhibitor 1 Cyto(SP,GO) - 2.45E+00 (IDKTDYMVGSYGPR;SIQEIQELDKDDESLR;SIQEIQELDKDDESLRK;TDYMVGSYGPR;AEEYEFLTPVEEAPK;VAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKK;VAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFK;FTDDDKTDHLSWEWNLTIK) - 1.14E-01 (IDKTDYMVGSYGPR;SIQEIQELDKDDESLR;SIQEIQELDKDDESLRK) - 1.46E-01 (SIQEIQELDKDDESLR;VAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKK;AEEYEFLTPVEEAPK) 1 IPI00003815.2
159 IPI00003817.2 Rho GDP-dissociation inhibitor 2 Cyto(SP,GO) - 9.63E-01 (APEPHVEEDDDDELDSK;APEPHVEEDDDDELDSKLNYKPPPQK;ATFMVGSYGPRPEEYEFLTPVEEAPK;ELQEMDKDDESLIK;KTLLGDGPVVTDPK;TLLGDGPVVTDPK;LTLVCESAPGPITMDLTGDLEALKK;SFFTDDDKQDHLSWEWNLSIK) - - 1.04E-01 (APEPHVEEDDDDELDSK;ATFMVGSYGPRPEEYEFLTPVEEAPK) - 2 IPI00003817.2, IPI00792537.1
160 IPI00003818.1 Kynureninase Cyto(SP,GO); Mito(GO) - 7.16E-01 (EGDSIAVILFSGVHFYTGQHFNIPAITK;IQDLPPVDLSLVNKDENAIYFLGNSLGLQPK;YLNAGAGGIAGAFIHEK;VALHLDEEDKLR;IEDILEVIEK;AFPSDHYAIESQLQLHGLNIEESMR;FTNLLTSILDSAETK;FTNLLTSILDSAETKN;HAHTIKPALVGWFGHELSTR;KPVVNII - - - - 1 IPI00003818.1
161 IPI00003831.4 Isoform XB of Plasma membrane calcium-transporting ATPase 3 PM(SP,GO) - 6.53E-03 (EASDIILTDDNFTSIVK;RQIYGQNFIPPK) - - - - 8 IPI00219262.2, IPI00219261.2, IPI00219260.2, IPI00219259.2, IPI00219258.2, IPI00219257.2, IPI00219256.2, IPI00003831.4
162 IPI00003833.3 Mitochondrial carrier homolog 2 Mito(G1,MitoP2,HPA) 1.13E+01 (EEGILGFFAGLVPR;EVSSSFDHVIK;GLFTGLTPR;LCSGVLGTVVHGK;QVCQLPGLFSYAQHIASIDGR;SAATLITHPFHVITLR;VLIQVGYEPLPPTIGR;YCGLCDSIITIYR;SMVQFIGR;GNSLFFR;VLQHYQESDKGEELGPGNVQK) 1.72E-01 (VLQHYQESDKGEELGPGNVQK;GLFTGLTPR;LCSGVLGTVVHGK;SAATLITHPFHVITLR;VLIQVGYEPLPPTIGR) 9.92E+00 (EVSSSFDHVIK;VLIQVGYEPLPPTIGR;YCGLCDSIITIYR;EEGILGFFAGLVPR;GLFTGLTPR;LCSGVLGTVVHGK;QVCQLPGLFSYAQHIASIDGR;SAATLITHPFHVITLR;SMVQFIGR;VLQHYQESDKGEELGPGNVQK;GNSLFFR) 1.65E+00 (EEGILGFFAGLVPR;EVSSSFDHVIK;GLFTGLTPR;SAATLITHPFHVITLR;VLIQVGYEPLPPTIGR;SMVQFIGR;VLQHYQESDKGEELGPGNVQK;GNSLFFR) 3.30E+00 (EEGILGFFAGLVPR;EVSSSFDHVIK;GLFTGLTPR;QVCQLPGLFSYAQHIASIDGR;SAATLITHPFHVITLR;SMVQFIGR;VLIQVGYEPLPPTIGR;GNSLFFR;VLQHYQESDKGEELGPGNVQK) 1.03E+00 (VLIQVGYEPLPPTIGR;YCGLCDSIITIYR;EEGILGFFAGLVPR;LCSGVLGTVVHGK;QVCQLPGLFSYAQHIASIDGR;SAATLITHPFHVITLR;VLQHYQESDKGEELGPGNVQK) 1 IPI00003833.3
163 IPI00003836.1 UDP-glucuronosyltransferase 2B10 precursor ER(G1) 1.29E+00 (KWDQFYSEVLGR;WDQFYSEVLGR;WIPQNDLLGHPK;LEVYPTSLTK;ANVIATALAK;FDGNKPDALGLNTR;IQHDQPVKPLDR;GHEVTVLASSASILFDPNDSSTLK;HSGGFIFPPSYVPVVMSK;TEFENIIMQLVK;VDFNTMSSTDLLNALK) - - 4.04E+00 (AVFWIEFVMR;KWDQFYSEVLGR;VDFNTMSSTDLLNALK;WDQFYSEVLGR;WIPQNDLLGHPK;AFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMK;ANVIATALAK;FDGNKPDALGLNTR;LSDQMTFMER;VLWRFDGNKPDALGLNTR;ADIWLMR;LEVYPTSLTK;TVINDPSYKE 1.17E+00 (AVFWIEFVMR;KWDQFYSEVLGR;VDFNTMSSTDLLNALK;WDQFYSEVLGR;WIPQNDLLGHPK;ANVIATALAK;FDGNKPDALGLNTR;LSDQMTFMER;ANVIATALAKIPQK;LEVYPTSLTK;TVINDPSYKENIMK;GHEVTVLASSASILFDPNDSSTLK;HSGGFIFPPSYVPVVMSK;TE 6.42E-02 (LEVYPTSLTK;WIPQNDLLGHPK;KWDQFYSEVLGR;ANVIATALAK;FDGNKPDALGLNTR;WDQFYSEVLGR) 1 IPI00003836.1
164 IPI00003843.1 Isoform A1 of Tight junction protein ZO-2 Nucl(G2); Cyto(GO,HPA); PM(GO,HPA) - 6.40E-03 (STGDIAGTVVPETNK;LNPTSNKSSR) - - - - 6 IPI00003843.1, IPI00216245.2, IPI00216246.3, IPI00291668.6, IPI00332453.1, IPI00797934.1
165 IPI00003856.1 Vacuolar ATP synthase subunit E Cyto(G1,GO) - 1.50E-01 (NDVDVQIDQESYLPEDIAGGVEIYNGDRK;ARDDLITDLLNEAK) - - - - 2 IPI00003856.1, IPI00719806.1
166 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein Cyto(G1,SP,GO); PM(GO) 1.63E-01 (DAGTIAGLNVLR;IINEPTAAAIAYGLDK;TTPSYVAFTDTER;STAGDTHLGGEDFDNR) 3.64E+00 (TTPSYVAFTDTER;VEIIANDQGNR;IINEPTAAAIAYGLDK;DAGTIAGLNVLR;EIAEAYLGK;HWPFMVVNDAGRPK;MKEIAEAYLGK;SFYPEEVSSMVLTK;TVTNAVVTVPAYFNDSQR;FDDAVVQSDMK;IINEPTAAAIAYGLDKK;RFDDAVVQSDMK;GPAVGIDLGTTYSCVGVFQH - 6.51E-01 (TTPSYVAFTDTER;NQVAMNPTNTVFDAK;RFDDAVVQSDMK;SFYPEEVSSMVLTK;MKEIAEAYLGK;DAGTIAGLNVLR;IINEPTAAAIAYGLDK;TVTNAVVTVPAYFNDSQR;ARFEELNADLFR;FEELNADLFR;MVNHFIAEFK;SINPDEAVAYGAAVQAAILSGDK;SQIHDIVLVGGS 4.42E-01 (TTPSYVAFTDTER;NQVAMNPTNTVFDAK;SFYPEEVSSMVLTK;DAGTIAGLNVLR;IINEPTAAAIAYGLDK;TVTNAVVTVPAYFNDSQR;MVNHFIAEFK;SINPDEAVAYGAAVQAAILSGDK;SQIHDIVLVGGSTR;STAGDTHLGGEDFDNR;ARFEELNADLFR;FEELNADLFR) 2.03E+00 (TTPSYVAFTDTER;GPAVGIDLGTTYSCVGVFQHGK;NQVAMNPTNTVFDAK;SFYPEEVSSMVLTK;RFDDAVVQSDMK;DAGTIAGLNVLR;TVTNAVVTVPAYFNDSQR;IINEPTAAAIAYGLDK;IINEPTAAAIAYGLDKK;LLQDFFNGK;QTQTFTTYSDNQPGVLIQVYEGER;SINPDEA 1 IPI00003865.1
167 IPI00003870.1 Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial precursor Mito(SP,GO,MitoP2,HPA) - 3.82E-02 (VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST;VLVHPPQDGEDEPTLVQK) 1.01E-01 (VLVHPPQDGEDEPTLVQK;VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST) - - - 1 IPI00003870.1
168 IPI00003881.5 heterogeneous nuclear ribonucleoprotein F Nucl(SP,GO,HPA); Cyto(GO,HPA) 3.48E-02 (ATENDIYNFFSPLNPVR;ITGEAFVQFASQELAEK) 7.24E-01 (ATENDIYNFFSPLNPVR;VHIEIGPDGR;ITGEAFVQFASQELAEK;MRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGR;QSGEAFVELGSEDDVK;YIEVFK;GLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTR;EEIVQFFSGLEIVPNGITLPVDPEGK) 5.43E-02 (ATENDIYNFFSPLNPVR;ITGEAFVQFASQELAEK) - - 2.68E+00 (ATENDIYNFFSPLNPVR;VHIEIGPDGR;EEIVQFFSGLEIVPNGITLPVDPEGK;ITGEAFVQFASQELAEK;GLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTR;QSGEAFVELGSEDDVK) 1 IPI00003881.5
169 IPI00003889.1 Isoform 1 of Protocadherin gamma A9 precursor PM(G2) - 9.46E-03 (VLENVPPGTWLLTATASDLDEGINGKVAYK;QNVYIPGSNATLTNAAGK) - - - - 1 IPI00003889.1
170 IPI00003904.1 Isoform 1 of Protocadherin gamma B7 precursor PM(G2) - 9.17E-03 (QNVYIPGSNATLTNAAGK;YTINIEAK) - - - - 1 IPI00003904.1
171 IPI00003905.1 Solute carrier family 2, facilitated glucose transporter member 2 PM(G1,GO) 5.10E+00 (AILQSLLLFFCPESPR;HVLGVPLDDR;SFEEIAAEFQK;VSIIQLFTNSSYR;FLGATETV;LGPSHILIIAGR;HVLGVPLDDRK) 1.34E-01 (SFEEIAAEFQK;VSIIQLFTNSSYR) 4.81E-01 (SFEEIAAEFQK;VSIIQLFTNSSYR;HVLGVPLDDR;HVLGVPLDDRK;FLGATETV) 3.78E-01 (HVLGVPLDDR;SFEEIAAEFQK;VSIIQLFTNSSYR;LGPSHILIIAGR) 3.22E+00 (FLGATETV;HVLGVPLDDR;HVLGVPLDDRK;LRGYDDVTKDINEMR;SFEEIAAEFQK;VSIIQLFTNSSYR;LGPSHILIIAGR) 2.51E+00 (LGPSHILIIAGR;SFEEIAAEFQK;VSIIQLFTNSSYR;AILQSLLLFFCPESPR;HVLGVPLDDR;HVLGVPLDDRK;FLGATETV) 1 IPI00003905.1
172 IPI00003918.5 60S ribosomal protein L4 Cyto(G1,GO,HPA); Nucl(GO,HPA) - 1.79E-01 (APIRPDIVNFVHTNLR;NVTLPAVFK;PLISVYSEK;PLISVYSEKGESSGK;FCIWTESAFR;GPCIIYNEDNGIIK;IEEVPELPLVVEDK;IEEVPELPLVVEDKVEGYK;RGPCIIYNEDNGIIK;NIPGITLLNVSK) - 1.90E-01 (APIRPDIVNFVHTNLR;PLISVYSEKGESSGK;IEEVPELPLVVEDK;NIPGITLLNVSK) 2.84E-01 (APIRPDIVNFVHTNLR;PLISVYSEK;NVTLPAVFK;IEEVPELPLVVEDK;IEEVPELPLVVEDKVEGYK;NIPGITLLNVSK) - 1 IPI00003918.5
173 IPI00003923.1 Isoform 1 of Uridine 5'-monophosphate synthase Cyto(G1,GO); Nucl(GO) - 1.02E-01 (IASWADLVNAHVVPGSGVVK;AALGPLVTGLYDVQAFK;FGDFVLK;SGLSSPIYIDLR;VTDAIVLLDR) - - - - 1 IPI00003923.1
174 IPI00003925.5 Isoform 1 of Pyruvate dehydrogenase E1 component subunit beta, mitochondrial precursor Mito(SP,GO,MitoP2) 2.30E-01 (VFLLGEEVAQYDGAYK;ILEDNSIPQVK) 9.83E-02 (VFLLGEEVAQYDGAYK;ILEDNSIPQVK) 2.82E-01 (ILEDNSIPQVK;VFLLGEEVAQYDGAYK;PVGHCLEAAAVLSK) 4.63E-02 (VFLLGEEVAQYDGAYK;ILEDNSIPQVK) 4.97E-02 (VFLLGEEVAQYDGAYK;IMEGPAFNFLDAPAVR) - 3 IPI00003925.5, IPI00549885.4, IPI00798351.1
175 IPI00003929.4 Glutathione S-transferase A3 Cyto(SP,GO); Mito(MitoP2) 4.32E-01 (AILNYIASK;WLLAAAGVEFEEK) 2.01E-01 (LVQTRAILNYIASKYNLYGK;AILNYIASK;AILNYIASKYNLYGK;ISNLPTVK;WLLAAAGVEFEEK;YFPAFEK;FLQPGSPR;GRMEPIRWLLAAAGVEFEEK) - - - - 1 IPI00003929.4
176 IPI00003944.1 Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor Mito(SP,GO,MitoP2,HPA); Cyto(GO,HPA) 1.96E-01 (LQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAK;NVQICSIFDIATELNR;PVIMPPEVAIGALGSIK;SYLENPAFMLLDLK) - 4.18E-01 (AASLGLLQFPILNASVDENCQNITYK;IPHFGYCDEIDLTELVK;LYYNLDDIAYVGK;LYYNLDDIAYVGKPLVDIETEALK;NVQICSIFDIATELNR;PLVDIETEALKDSEEDVVETPAVSHDEHTHQEIK;SYLENPAFMLLDLK;ILKEDILNYLEK;LGSVGQLSTTDLTGGTFTLSNIGSIG 1.05E-01 (ILKEDILNYLEK;PVIMPPEVAIGALGSIK;SYLENPAFMLLDLK) 2.82E-02 (PVIMPPEVAIGALGSIK;SYLENPAFMLLDLK) 3.34E-02 (NVQICSIFDIATELNR;ILKEDILNYLEK) 1 IPI00003944.1
177 IPI00003949.1 Ubiquitin-conjugating enzyme E2 N Cyto(G1,SP,GO); Nucl(SP,GO) - 2.95E-01 (YFHVVIAGPQDSPFEGGTFK;LLAEPVPGIK) - - 2.24E-01 (FMTKIYHPNVDKLGR;YFHVVIAGPQDSPFEGGTFK) - 2 IPI00003949.1, IPI00796342.1
178 IPI00003965.4 Ubiquitin carboxyl-terminal hydrolase 7 Nucl(SP,GO); Cyto(SP) - 5.29E-02 (DDPENDNSELPTAK;DPANYILHAVLVHSGDNHGGHYVVYLNPK;EVFGTFGIPFLLR;FDKDHDVMLFLK;LSEVLQAVTDHDIPQQLVER;NIFESFVDYVAVEQLDGDNK;AGFIQDTSLILYEEVKPNLTER;FEFPEQLPLDEFLQK;IEEIPLDQVDIDKENEMLVTVAHFHK;VFYELQHSDK - - 1.15E-02 (MKGTCVEGTIPK;LNTDPMLLQFFK) 4.76E-02 (INDRFEFPEQLPLDEFLQK;NIFESFVDYVAVEQLDGDNK;TIPNDPGFVVTLSNR;VFYELQHSDKPVGTK;FEFPEQLPLDEFLQK;DLLQFFKPR) 3 IPI00003965.4, IPI00646721.1, IPI00783739.1
179 IPI00003968.1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial precursor Mito(SP,GO,MitoP2) 2.91E+00 (DAFPEAIIVKPSDIFGR;IPQAIAQLSK;NFDFEDVFVK;VVQHSNVVINLIGR;FIHVSHLNANIK;FGPIPLGSLGWK;GIVNAVKDPDANGK;LFLPFPLPLFAYR;SFAFVGPSR;YLLFHLVK;SSVSGIVATVFGATGFLGR;LPHLPGLEDLGIQATPLELK;VFEISPFEPWITR;WLSAEI - 3.98E-01 (LPHLPGLEDLGIQATPLELK;VFEISPFEPWITR;SFAFVGPSR;LFLPFPLPLFAYR) 1.37E-01 (DAFPEAIIVKPSDIFGR;LFLPFPLPLFAYR;LPHLPGLEDLGIQATPLELK;VFEISPFEPWITR;WLSAEIEDVKPAK) 4.41E-01 (DAFPEAIIVKPSDIFGR;FIHVSHLNANIK;MGSQVIIPYR;NFDFEDVFVK;VVQHSNVVINLIGR;LFLPFPLPLFAYR;SFAFVGPSR;LPHLPGLEDLGIQATPLELK;VFEISPFEPWITR;WLSAEIEDVKPAK) 3.49E-02 (SSVSGIVATVFGATGFLGR;MGSQVIIPYRCDK) 1 IPI00003968.1
180 IPI00003985.1 Mitochondrial chaperone BCS1 Mito(G1,SP,GO,MitoP2) 3.90E-01 (DNPYFGAGFGLVGVGTALALAR;DVQEFIDNPK;LNHLLSVAPQQSLVLLEDVDAAFLSR;LTFSGLLNALDGVASTEAR;NDPVGAIHNAESLR;RPLNSVVLQQGLADR;FYPGQAPSLAENFAEHVLR) - 3.53E-01 (DNPYFGAGFGLVGVGTALALAR;FYPGQAPSLAENFAEHVLR;LNHLLSVAPQQSLVLLEDVDAAFLSR;LTFSGLLNALDGVASTEAR;TQHLSVETSYLQHESGR;NDPVGAIHNAESLR) - 5.05E-02 (DNPYFGAGFGLVGVGTALALAR;LTFSGLLNALDGVASTEAR;DVQEFIDNPK) - 1 IPI00003985.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home