Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
181 IPI00004068.2 Mediator of RNA polymerase II transcription subunit 12 PM(G2); Nucl(GO) - - - 1.08E-02 (PDVEKEVKPPPK;QTRDVITCEPQGSLIDTKGNK;SQSAINTWFTDLAGTK) - 9.13E-03 (NRPEAFPTAEDIFAK;CILAYLYDLYTSCSHLKNK) 2 IPI00004068.2, IPI00640149.1
182 IPI00004101.3 Betaine--homocysteine S-methyltransferase Cyto(SP,HPA) 8.33E-01 (AIAEELAPER;QGFIDLPEFPFGLEPR) 9.26E+00 (AGASIIGVNCHFDPTISLK;AGPWTPEAAVEHPEAVR;AHLMSQPLAYHTPDCNK;ISGQEVNEAACDIAR;QVADEGDALVAGGVSQTPSYLSCK;KVFLQQLEVFMK;PVAATMCIGPEGDLHGVPPGECAVR;QGFIDLPEFPFGLEPR;VFLQQLEVFMK;AGSNVMQTFTFYASEDK;AGSNVMQ - 3.46E-01 (AIAEELAPER;QGFIDLPEFPFGLEPR;AGSNVMQTFTFYASEDKLENR) 1.04E+00 (AGPWTPEAAVEHPEAVR;AGSNVMQTFTFYASEDKLENR;AIAEELAPER;KVFLQQLEVFMK;LNAGEIVIGDGGFVFALEK;QGFIDLPEFPFGLEPR;VFLQQLEVFMK) 6.29E-02 (QGFIDLPEFPFGLEPR;LNAGEIVIGDGGFVFALEK) 1 IPI00004101.3
183 IPI00004233.2 Isoform Long of Antigen KI-67 Nucl(SP,GO,HPA) - - - - 4.95E-03 (EEAQALEDLTGFK;VGVKEEVLPVGKLTQTSGK;QTPSAGKAMHTPK) - 2 IPI00004233.2, IPI00413173.3
184 IPI00004237.1 Phosphorylase b kinase regulatory subunit alpha, liver isoform Cyto(G1,GO) - 2.20E-01 (AALEAIDELDLFGAHGGR;AYELEQNVVK;CHGLSIDGYVLPSSTTR;DCSNLQDQADILYILYVIK;DQATGICHFFYDSAPSGAYGTMTYLTR;FAVHVESVLNR;GPSWDTNLSGQHGVTVQNLLGELYGK;HGVNVQSIADIHPIQVQPGR;IISAPLPPEELTK;NLLHHILSGK;QLTVGLPPE - - 1.26E-02 (AALEAIDELDLFGAHGGR;FSADEQFFSVGQAASSSAHSSK) - 1 IPI00004237.1
185 IPI00004273.6 RNA binding motif protein 25 Cyto(SP,GO,HPA); Nucl(SP,GO,HPA) - - - - - 3.67E-01 (ASNGNARPETVTNDDEEALDEETK;EYSSELNAPSQESDSHPR;FPVAPLIPYPLITK;LLAEGHPDPDAELQR;RFPVAPLIPYPLITK;LLHDLQIGEK;IIEYIGEEEATLVDFVCSK) 1 IPI00004273.6
186 IPI00004294.4 Ankyrin repeat domain-containing protein 1 Nucl(SP) - - - 3.29E-02 (ENSYKTSRIATF;LLSTALHVAVR) - - 1 IPI00004294.4
187 IPI00004312.1 Isoform Long of Signal transducer and activator of transcription 2 Cyto(G2,SP,GO,HPA); PM(GO,HPA); Nucl(SP,GO) 2.78E-02 (FNILTSNQKTLTPEK;GLSCLVSYQDDPLTKGVDLR) - - - - - 2 IPI00004312.1, IPI00219076.1
188 IPI00004324.1 Trafficking protein particle complex subunit 3 ER(G2); Cyto(GO,HPA) - - - - 1.25E-01 (GALEMVQMAVEAK;LIEDFLAR;RIEDNLPAGEE) - 2 IPI00004324.1, IPI00640089.1
189 IPI00004337.1 Zinc finger and BTB domain-containing protein 11 Nucl(G1,HPA) - - - - - 1.61E-02 (LSEVAEAIQTVK;ENNTVSNIHPK) 1 IPI00004337.1
190 IPI00004344.1 Isoform 1 of AF4/FMR2 family member 4 Nucl(SP,GO,HPA); Mito(GO,HPA) 1.60E-02 (KKGQHGSEHSK;TSNGHQSKSMLK) - 9.02E-03 (VMGPLIFNASIMTDLVRYTR;LSSEHYSSQSHGNSMTELKPSSK) 2.41E-02 (ELLSPLSEPDDRYPLIVK;RLTVLCLRCESLLYLR) 3.10E-02 (ELLSPLSEPDDRYPLIVK;DLLPSPAGPVPSK;FPFPTKESQQSNFGTGEQK) - 1 IPI00004344.1
191 IPI00004358.3 Glycogen phosphorylase, brain form Cyto(G1,GO) - 6.68E-01 (QEYFVVAATLQDIIR;VIFLENYR;LAACFLDSMATLGLAAYGYGIR;LKQEYFVVAATLQDIIR;VLYPNDNFFEGK;HLHFTLVK;LVTSIGDVVNHDPVVGDR;VFADYEAYMQCQAQVDQLYR;VIPAADLSQQISTAGTEASGTGNMK;EYYDHLPELK;VEDVEALDR;QAVDQISSGFFSPK; - 1.40E-02 (LKQEYFVVAATLQDIIR;VLYPNDNFFEGK;VIFLENYR;LVTSIGDVVNHDPVVGDR;IGEEFLTDLSQLK) - - 1 IPI00004358.3
192 IPI00004362.2 MORC family CW-type zinc finger protein 1 Cyto(G2) - - 2.17E-02 (NLRIKLALLLQK;SNTDVSLKQEK) - - - 1 IPI00004362.2
193 IPI00004373.1 Mannose-binding protein C precursor ER(G1) - - - 5.78E-01 (EEAFLGITDEK;EEAFLGITDEKTEGQFVDLTGNR;FFLTNGEIMTFEK;NAAENGAIQNLIK;TEGQFVDLTGNR;WLTFSLGK) 4.51E-01 (EEAFLGITDEKTEGQFVDLTGNR;FFLTNGEIMTFEK;TEGQFVDLTGNR;EEAFLGITDEK;NAAENGAIQNLIK) - 1 IPI00004373.1
194 IPI00004388.1 Tyrosine-protein phosphatase non-receptor type 21 Cyto(G2) - 1.31E-02 (RNSIEVAGLSHGLEGLR;VLEEATQKVALLHQKYR;TQREGPEEAEGLRYGHK) - - - - 1 IPI00004388.1
195 IPI00004397.1 Ras-related protein Ral-B PM(SP,GO); Cyto(GO) - 2.62E-02 (VKAEEDKIPLLVVGNK;SALTLQFMYDEFVEDYEPTK) - 2.59E-01 (AEEDKIPLLVVGNK;VKAEEDKIPLLVVGNK;VFFDLMR;SALTLQFMYDEFVEDYEPTK) 5.65E-01 (AEEDKIPLLVVGNK;SKAEEWGVQYVETSAK;VFFDLMR;VKAEEDKIPLLVVGNK;VVLDGEEVQIDILDTAGQEDYAAIR;VIMVGSGGVGK;SALTLQFMYDEFVEDYEPTK) 1.06E-01 (SKAEEWGVQYVETSAK;VKAEEDKIPLLVVGNK) 1 IPI00004397.1
196 IPI00004433.1 Contactin-6 precursor Cyto(G2) - - - 1.43E-02 (GPPGPPEDVQVEDISSTTSQLSWRAGPDNNSPIQIFTIQTR;ASVPVVAPVNIHGGGGSR) - - 1 IPI00004433.1
197 IPI00004436.1 U6 snRNA-associated Sm-like protein LSm1 Nucl(G2,GO); Cyto(GO) - 4.74E-02 (ESDTPLQQVSIEEILEEQR;SIDQFANLVLHQTVER) - - - - 1 IPI00004436.1
198 IPI00004446.1 Sushi-repeat protein Cyto(G2,SP,GO) - 1.88E-02 (INVNVNSAAGLLDQFYEK;MQISMLQQSTCGLDLR) - - - - 1 IPI00004446.1
199 IPI00004450.1 testes-specific heterogenous nuclear ribonucleoprotein G-T Nucl(SP,HPA) - - - 1.30E-02 (GFAFVTFESPADAK;VPRGGGRLGGR) - - 1 IPI00004450.1
200 IPI00004457.2 Membrane copper amine oxidase ER(G1); PM(GO) - 3.40E-02 (SPVPPGPAPPLQFYPQGPR;YQLAVTQR;YGNQVSEHTLGTVHTHSAHFK) - - 5.93E-01 (EALAIVFFGR;SPVPPGPAPPLQFYPQGPR;HHSDLYSHYFGGLAETVLVVR;KLLEMEEQAAFLVGSATPR;LGPGLVDAAQAR;NLVTMTTAPR;RPVLFQEYLDIDQMIFNR;YVDGGFGMGK) - 1 IPI00004457.2
201 IPI00004461.2 Isoform 1 of Deoxyguanosine kinase, mitochondrial precursor Mito(SP,GO,MitoP2) - - 4.14E-02 (TYPEWHVATEPVATWQNIQAAGTQK;WSYTFQTFSFLSR) - - - 2 IPI00221317.1, IPI00004461.2
202 IPI00004488.1 Vacuolar ATP synthase subunit F Mito(G2); Cyto(GO) - - - 1.02E-01 (DDIGIILINQYIAEMVR;HALDAHQQSIPAVLEIPSK) - - 1 IPI00004488.1
203 IPI00004494.1 Semaphorin-3E precursor Cyto(G2) - - 1.38E-02 (YGTTKDYPDDAIRFAR;LRLSHKELLNLNR) - - - 1 IPI00004494.1
204 IPI00004497.1 Breakpoint cluster region protein Nucl(G1); Cyto(GO) - - - - - 7.28E-02 (QCVEEIER;HQDGLPYIDDSPSSSPHLSSK;GSRDALVSGALESTKASELDLEK) 2 IPI00004497.1, IPI00472302.1
205 IPI00004503.5 lysosomal-associated membrane protein 1 ER(G1); PM(SP,GO) 9.99E-01 (ALQATVGNSYK;FFLQGIQLNTILPDAR;TVESITDIR) - 2.55E-01 (FFLQGIQLNTILPDAR;TVESITDIR) 2.53E-01 (FFLQGIQLNTILPDAR;TVESITDIR;AFSVNIFK;ENTSDPSLVIAFGR) 8.35E-01 (AFSVNIFK;ENTSDPSLVIAFGR;FFLQGIQLNTILPDAR;TVESITDIR) 9.90E-02 (TVESITDIR;FFLQGIQLNTILPDAR) 1 IPI00004503.5
206 IPI00004521.3 ETAA16 protein Cyto(SP,GO,HPA); Nucl(GO,HPA) - - - - 1.41E-02 (QGSNLVQSK;HLNPGSISVQTSLTNSSQIDK) - 1 IPI00004521.3
207 IPI00004534.3 Phosphoribosylformylglycinamidine synthase Cyto(G1,GO) - 1.02E-01 (ANQELGLALDSWDLDFYTK;GHLLYVALSPGQHR;GVAFVGGFSYADVLGSAK;HVVFTAETHNFPTGVCPFSGATTGTGGR;LGGTALAQCFSQLGEHPPDLDLPENLVR;LNFSTPTSTNIVSVCR;LSFAHPPSAEVEAIALATLHDR;PLEVAIEASNGASDYGNK;SVGGLVAQQQCVGPLQTPL - - - - 1 IPI00004534.3
208 IPI00004550.5 Keratin 24 Nucl(G1); Cyto(GO,HPA) 2.06E-02 (QSVEADINGLR;LAADDFR;TIVEELVDGKVVSSQVSSISEVK) - - - 1.30E-02 (QSVEADINGLR;YGPGSGDGGSGRDYSK) 1.55E-02 (QSVEADINGLR;VVSSQVSSISEVKVK) 1 IPI00004550.5
209 IPI00004560.1 Isoform 2 of Serine/threonine-protein kinase DCAMKL1 Cyto(G2); Nucl(G2); PM(GO) - - 1.60E-02 (TIYTIDGLKK;SKSPASTSSVNGTPGSQLSTPR) - - - 3 IPI00004560.1, IPI00217247.1, IPI00644293.2
210 IPI00004657.1 HLA class I histocompatibility antigen, B-7 alpha chain precursor ER(G1); PM(GO) 5.51E-02 (APWIEQEGPEYWDR;DGEDQTQDTELVETRPAGDR;WAAVVVPSGEEQR;DGEDQTQDTELVETR;YFYTSVSR;AYLEGECVEWLR;FISVGYVDDTQFVR) - - 6.19E-02 (DGEDQTQDTELVETR;DYIALNEDLR;WAAVVVPSGEEQR;FISVGYVDDTQFVR;YFYTSVSR;LERADPPKTHVTHHPISDHEATLR) 8.20E-01 (DYIALNEDLR;YFYTSVSR;APWIEQEGPEYWDR;FISVGYVDDTQFVR;WAAVVVPSGEEQR;DGEDQTQDTELVETR;DGEDQTQDTELVETRPAGDR;SWTAADTAAQITKR) - 1 IPI00004657.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home