Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
211 IPI00004669.1 Polypeptide N-acetylgalactosaminyltransferase 2 Cyto(G2) 6.79E-02 (WYLENVYPELR;NFYYAAVPSAR) - - - 5.49E-02 (EIILVDDYSNDPEDGALLGK;WPDFNQEAYVGGTMVR;TPMIAGGLFVMDK;WYLENVYPELR) - 1 IPI00004669.1
212 IPI00004671.1 Golgin subfamily B member 1 Cyto(G2) - 2.21E-03 (SSTEEEMEIEKIKHK;EDLNQVITIK) - - - - 2 IPI00004671.1, IPI00796891.1
213 IPI00004672.3 41 kDa protein Nucl(G1) - - - - - 4.39E-02 (DGEDQTQDTELVETR;DGEDQTQDTELVETRPAGDGTFQK;FISVGYVDDTQFVR;WAAVVVPSGEEQR;ETLQRAGTPPK) 1 IPI00004672.3
214 IPI00004712.1 Checkpoint protein HUS1 Mito(G2); Cyto(SP); Nucl(SP,GO,HPA) - 3.62E-02 (DLQEPVVPDPDVSIYLPVLK;LWKDLQEPVVPDPDVSIYLPVLK) - - - - 1 IPI00004712.1
215 IPI00004815.3 SEC14-like protein 4 Cyto(G2) - 6.55E-02 (ENLQDLLPILPNADDYFLLR;GSSLQVENEILFPGCVLR;VGDLSPQQQEALAR;KLSYTVEVLLPDKASEETLQSLK;FRENLQDLLPILPNADDYFLLR) - - - - 1 IPI00004815.3
216 IPI00004839.1 Crk-like protein Cyto(G2,GO) - 8.00E-02 (IGDQEFDHLPALLEFYK;IHYLDTTTLIEPAPR;TLYDFPGNDAEDLPFK) - - - - 1 IPI00004839.1
217 IPI00004845.4 Protein NipSnap3A Cyto(SP) - 7.86E-02 (LVGVFHTEYGALNR;VHVLWWNESADSR;DKEWQEQFLIPNLALIDK) 6.94E-01 (DKEWQEQFLIPNLALIDK;QESEITYLVPWCK;TAHSELVGYWSVEFGGR;LVGVFHTEYGALNR;PGGPALWGDAFK;VHVLWWNESADSR) - 9.94E-02 (LVGVFHTEYGALNR;VHVLWWNESADSR;MNEFLENFEK) - 1 IPI00004845.4
218 IPI00004859.1 Bloom syndrome protein Nucl(SP,GO,HPA); Cyto(GO,HPA) - 9.05E-03 (TLNNKLSLSK;DGLAALAYHAGLSDSARDEVQQK) - - - - 2 IPI00004859.1, IPI00479631.1
219 IPI00004860.2 Isoform Complexed of Arginyl-tRNA synthetase, cytoplasmic Cyto(SP,GO,HPA); Nucl(GO,HPA) - 3.76E-01 (AAYPDLENPPLLVTPSQQAK;DFVSEQLTSLLVNGVQLPALGENKK;FPDYLTVSPPIGDLQVFYK;GFDILGIKPVQR;ILLDHEKEWK;IVFVPGCSIPLTIVK;IYDALDVSLIER;SDGGYTYDTSDLAAIK;VEIAGPGFINVHLR;VLTAEELNAAQTSVAYGCIK;AYQCVVLLQGK;KDFVS - 3.27E-02 (LNDYIFSFDK;SDGGYTYDTSDLAAIK;STIIGESISR;VIVDFSSPNIAK) 4.38E-02 (AAYPDLENPPLLVTPSQQAK;FPDYLTVSPPIGDLQVFYK;MNDIVKEFEDRGFVQVDDGR;LFEFAGYDVLR) - 1 IPI00004860.2
220 IPI00004944.3 Isoform 1 of Sodium-driven chloride bicarbonate exchanger PM(SP,GO) 2.24E-02 (SLHGEYVGR;LMDLLFTKR) - - - - - 2 IPI00004944.3, IPI00746904.2
221 IPI00004957.1 Angiopoietin-related protein 3 precursor Nucl(G1) - - - - - 3.34E-02 (QSNYVLRIELEDWK;GLSWKSQNGRLYSIK) 1 IPI00004957.1
222 IPI00004962.2 golgi phosphoprotein 4 Cyto(G2); Nucl(GO,HPA) 4.32E-02 (LAVQQVEEAQQLR;SALAAAQTQVAEYK;QAELEEGRPQHQEQLR) - - - 9.32E-02 (FQSPYEEQLEQQR;SALAAAQTQVAEYK;YQQHQESLSAQLQVVYEHR;GREEHYEEEEEEEEDGAAVAEK;LAVQQVEEAQQLR;EEHYEEEEEEEEDGAAVAEKSHRR) - 1 IPI00004962.2
223 IPI00004968.1 Pre-mRNA-processing factor 19 Nucl(SP,GO); Cyto(SP,GO) - 3.89E-02 (TLQLDNNFEVK;TNVANFPGHSGPITSIAFSENGYYLATAADDSSVK;TVPEELVKPEELSK) - - - 3.36E+00 (ALQDEWDAVMLHSFTLR;TNVANFPGHSGPITSIAFSENGYYLATAADDSSVK;KVTSVVFHPSQDLVFSASPDATIR;SSEQILATLK;TLQLDNNFEVK;TVPEELVKPEELSK;VAHPIRPKPPSATSIPAILK;VTSVVFHPSQDLVFSASPDATIR;YIAENGTDPINNQPLSEEQLIDIK;AHE 1 IPI00004968.1
224 IPI00004970.3 Small subunit processome component 20 homolog Nucl(SP,GO) - - 6.40E-03 (NEQFPVLDHLLSIIKLPPNK;QHGILNSLEIVLK) 4.55E-03 (EIDPENFK;DWLFDMVTTWFGAKK) 4.89E-03 (FPLPSIETK;LLETYLILVK) 5.80E-03 (IIEDLGVHFLQYVLK;RSKSYDSYEILGK) 1 IPI00004970.3
225 IPI00004978.2 Zinc finger protein 133 Nucl(G2) - - 1.72E-02 (EVMLENYSNLVSLGISFSK;HQKAHSGEKPIVCR) - - - 2 IPI00004978.2, IPI00797700.1
226 IPI00005018.3 Isoform 1 of Upstream-binding protein 1 Nucl(SP,GO) - - - - - 8.39E-02 (AESSDGIHIILK;TNPSQLNAVEFLWDPAKR) 2 IPI00005018.3, IPI00294870.4
227 IPI00005038.1 Ribonuclease UK114 Cyto(SP,GO); Nucl(SP,GO) 8.06E-01 (AAYQVAALPK;IEIEAVAIQGPLTTASL;TTVLLADINDFNTVNEIYK;AAGCDFTNVVK;APGAIGPYSQAVLVDR) 6.54E+00 (AAGCDFTNVVK;TTVLLADINDFNTVNEIYK;AAYQVAALPK;AAYQVAALPKGSRIEIEAVAIQGPLTTASL;IEIEAVAIQGPLTTASL;APGAIGPYSQAVLVDR;TIYISGQIGMDPSSGQLVSGGVAEEAK) - 3.98E-01 (AAYQVAALPK;TTVLLADINDFNTVNEIYK;IEIEAVAIQGPLTTASL;APGAIGPYSQAVLVDR) 1.71E+00 (AAYQVAALPK;IEIEAVAIQGPLTTASL;TTVLLADINDFNTVNEIYK;APGAIGPYSQAVLVDR) 1.24E+00 (AAGCDFTNVVK;TTVLLADINDFNTVNEIYK;APGAIGPYSQAVLVDR) 1 IPI00005038.1
228 IPI00005087.1 Tropomodulin-3 Mito(G1) 1.61E-01 (FGYQFTKQGPR;ILPVFDEPPNPTNVEESLK;QLETVLDDLDPENALLPAGFR;TKENDAHLVEVNLNNIK;YKDLDEDELLGNLSETELK) 1.03E-01 (DREDYVPYTGEK;ENDAHLVEVNLNNIK;FGYQFTKQGPR;QLETVLDDLDPENALLPAGFR;VSLDPELEEALTSASDTELCDLAAILGMHNLITNTK;TKENDAHLVEVNLNNIK) - - - 1.44E-01 (DREDYVPYTGEK;SLNVESNFITGVGILALIDALR;YKDLDEDELLGNLSETELK;TKENDAHLVEVNLNNIK;ILPVFDEPPNPTNVEESLKR) 1 IPI00005087.1
229 IPI00005102.3 Spermine synthase Cyto(G2,GO) - 8.45E-02 (DVLILGGGDGGILCEIVK;IYPHGLVLLDLQSYDGDAQGKEEIDSILNK) - - - - 3 IPI00005102.3, IPI00513710.2, IPI00643452.1
230 IPI00005118.1 Hexokinase-3 Cyto(G1,GO) - 2.43E-01 (FLSEIESDSLALR;GAALVTAVACR;AAQLCAAALAAVLSCLQHSR;AAQLCGAGVAAVVEK;CSGVEGQDVVQLLR;FDASVDQASINPGK;GDFLALDLGGTNFR;GVAMVTAVAAR;HILLHLTSLGVLFR;VHAILQDLGLSPGASDVELVQHVCAAVCTR;VLWVTLTGIEGHR;VTTGVQITSE - - - - 1 IPI00005118.1
231 IPI00005129.7 Isoform 1 of Secretory carrier-associated membrane protein 1 ER(G1) - - - - 2.75E-01 (AQQEFATGVMSNK;TVQTAAANAASTAASSAAQNAFK;EHALAQAELLK;MPNVPNTQPAIMKPTEEHPAYTQIAK;NVPPGLDEYNPFSDSR) - 1 IPI00005129.7
232 IPI00005158.1 Lon protease homolog, mitochondrial precursor Mito(SP,GO,MitoP2,HPA); Cyto(GO,HPA) - 5.18E-02 (ILCFYGPPGVGK;GYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSK;ILEFIAVSQLR;VVDNPIYLSDMGAALTGAESHELQDVLEETNIPK;TKTENPLILIDEVDK) 7.42E-01 (ELGLEKDDKDAIEEK;IVSGEAESVEVTPENLQDFVGKPVFTVER;LGLLDNHSSEFNVTR;TENPLILIDEVDK;YSNENLDLAR;EIFDIAFPDEQAEALAVER;GYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSK;ILEFIAVSQLR) - - 4.24E-02 (GYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSK;SIARALNREYFR) 3 IPI00005158.1, IPI00334291.7, IPI00642982.1
233 IPI00005159.3 Actin-like protein 2 ER(G1); Cyto(SP) 5.28E-02 (HLWDYTFGPEK;GYAFNHSADFETVR) - - 9.56E-02 (HMVFLGGAVLADIMK;ILLTEPPMNPTK;GYAFNHSADFETVR) 2.05E-01 (DLMVGDEASELR;HMVFLGGAVLADIMK;SMLEVNYPMENGIVR;GYAFNHSADFETVR;HIVLSGGSTMYPGLPSR;ILLTEPPMNPTK) - 1 IPI00005159.3
234 IPI00005160.2 Actin-related protein 2/3 complex subunit 1B Nucl(G1); Cyto(SP) - 6.49E-02 (ASSEGGTAAGAGLDSLHK;STVLSLDWHPNNVLLAAGSCDFK;VAWVSHDSTVCLADADK;EVEERPAPTPWGSK) - - - 4.67E-01 (ASSEGGTAAGAGLDSLHK;EHNGQVTGIDWAPESNR;NSVSQISVLSGGK) 2 IPI00005160.2, IPI00737530.1
235 IPI00005161.3 Actin-related protein 2/3 complex subunit 2 Cyto(G1,SP,GO,HPA) - 7.48E-01 (DTDAAVGDNIGYITFVLFPR;ELQAHGADELLK;ELQAHGADELLKR;FENAAAGNKPEAVEVTFADFDGVLYHISNPNGDK;FENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTK;RVYGSFLVNPESGYNVSLLYDLENLPASK;YFQFQEEGKEGENR;ASHTAPQVLFSHR;DNTINLIHTFR - 8.53E-02 (DSIVHQAGMLK;DTDAAVGDNIGYITFVLFPR;ELQAHGADELLK;ASHTAPQVLFSHR) 1.10E-01 (FENAAAGNKPEAVEVTFADFDGVLYHISNPNGDK;YFQFQEEGKEGENR;ELQAHGADELLK;MILLEVNNR;VTVVFSTVFK;FENAAAGNK) 1.24E+00 (DTDAAVGDNIGYITFVLFPR;ELQAHGADELLKR;FENAAAGNKPEAVEVTFADFDGVLYHISNPNGDK;RVYGSFLVNPESGYNVSLLYDLENLPASK;YFQFQEEGKEGENR;ASHTAPQVLFSHR;DNTINLIHTFR;VTVVFSTVFKDDDDVVIGK;VYGSFLVNPESGYNVSLLYDLENLPASK; 1 IPI00005161.3
236 IPI00005162.2 Actin-related protein 2/3 complex subunit 3 Cyto(G1,SP) - 3.57E-01 (PAYHSSLMDPDTK;DTDIVDEAIYYFK;ETKDTDIVDEAIYYFK;AYLQQLR) - 1.43E-01 (PAYHSSLMDPDTK;DTDIVDEAIYYFK;EMYTLGITNFPIPGEPGFPLNAIYAK) - 5.46E-01 (DTDIVDEAIYYFK;ETKDTDIVDEAIYYFK) 1 IPI00005162.2
237 IPI00005171.1 HLA class II histocompatibility antigen, DR alpha chain precursor ER(SP); PM(SP,GO) 3.22E-01 (FASFEAQGALANIAVDK;NGKPVTTGVSETVFLPR) 1.15E-01 (FHYLPFLPSTEDVYDCR;NGKPVTTGVSETVFLPR;FASFEAQGALANIAVDK) 1.52E-01 (FASFEAQGALANIAVDK;NGKPVTTGVSETVFLPR) 5.80E-01 (FASFEAQGALANIAVDK;NGKPVTTGVSETVFLPR;VEHWGLDEPLLK) 2.99E+00 (FASFEAQGALANIAVDK;NGKPVTTGVSETVFLPR;PVTTGVSETVFLPR;EPNVLICFIDK;SNYTPITNVPPEVTVLTNSPVELR;VEHWGLDEPLLK) 8.66E-01 (FHYLPFLPSTEDVYDCR;NGKPVTTGVSETVFLPR;FASFEAQGALANIAVDK) 2 IPI00005171.1, IPI00464948.3
238 IPI00005179.1 Isoform 1 of DNA-directed RNA polymerase I 40 kDa polypeptide Nucl(G1,GO) - - - - - 1.84E-01 (CFSPGVIEVQEVQGK;LLPDITLLEPVEGEAAEELSR) 2 IPI00005179.1, IPI00217386.1
239 IPI00005181.1 Phospholipid scramblase 1 ER(G1); PM(GO) - - - - 2.92E-01 (EAFTDADNFGIQFPLDLDVK;IIDNMGQEVITLER) - 2 IPI00005181.1, IPI00797396.1
240 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha Nucl(G2,SP,GO,HPA); Cyto(SP) - 9.56E-03 (LENYFEELLK;TVQSPNSSVPSPGLAGPVTMTSVHPPIR) 1.26E-02 (KTEGLVKLTPIDK;LENYFEELLK) - - - 2 IPI00005184.1, IPI00184317.2
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home