Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
241 IPI00005198.2 Interleukin enhancer-binding factor 2 Cyto(SP); Nucl(SP,GO,HPA) - 2.20E-01 (GTMTTGHNVADLVVILK;NQDLAPNSAEQASILSLVTK;ILPTLEAVAALGNK;VLQSALAAIR;KLDPELHLDIK;WFEENASQSTVK) - - - 2.08E+00 (ILITTVPPNLR;ILPTLEAVAALGNK;INNVIDNLIVAPGTFEVQIEEVR;RNQDLAPNSAEQASILSLVTK;VLQSALAAIR;NQDLAPNSAEQASILSLVTK;VKPAPDETSFSEALLK;WFEENASQSTVK;LDPELHLDIK) 1 IPI00005198.2
242 IPI00005202.2 Membrane-associated progesterone receptor component 2 ER(G1) 1.62E+00 (GLATFCLDK;DFSLEQLR;FYGPAGPYGIFAGR;GLGAGAGAGEESPATSLPR;RGLGAGAGAGEESPATSLPR) - - 7.63E+00 (DALRDEYDDLSDLNAVQMESVR;DEYDDLSDLNAVQMESVR;DFSLEQLR;FYGPAGPYGIFAGR;GLGAGAGAGEESPATSLPR;LLKPGEEPSEYTDEEDTK;RDFSLEQLR;RGLGAGAGAGEESPATSLPR;EWEMQFK;LLKPGEEPSEYTDEEDTKDHNK) 6.72E+00 (DALRDEYDDLSDLNAVQMESVR;DEYDDLSDLNAVQMESVR;DFSLEQLR;FYGPAGPYGIFAGR;GLGAGAGAGEESPATSLPR;LLKPGEEPSEYTDEEDTK;RGLGAGAGAGEESPATSLPR;RDFSLEQLR;KRDFSLEQLR) 8.71E-01 (GLATFCLDK;FYGPAGPYGIFAGR;GLGAGAGAGEESPATSLPR;RGLGAGAGAGEESPATSLPR;DFSLEQLR;GLATFCLDKDALR) 1 IPI00005202.2
243 IPI00005367.1 Isoform A of 5'-AMP-activated protein kinase subunit gamma-2 Nucl(G2,GO); Cyto(GO) - 8.10E-03 (FDVINLAAEK;PSSPMSAPVR) - - - - 2 IPI00646448.1, IPI00005367.1
244 IPI00005474.5 Phospholysine phosphohistidine inorganic pyrophosphate phosphatase Cyto(G1,HPA); Nucl(HPA) - 1.19E+00 (ADGYVDNLAEAVDLLLQHADK;AEVVGKPSPEFFK;ALEYACGIK;SALQAIGVEAHQAVMIGDDIVGDVGGAQR;SRAELVGQLQR;AELVGQLQR;LGFDISEQEVTAPAPAACQILK;PSPEFFK) - - - 4.27E-01 (ADGYVDNLAEAVDLLLQHADK;LGFDISEQEVTAPAPAACQILK) 1 IPI00005474.5
245 IPI00005487.1 Ribokinase Cyto(G1) - 3.44E-01 (DSFGNDYIENLK;FFIGFGGK;VMVCQLEITPATSLEALTMAR;SNFIAAVSVQAAGTQSSYPYK) - - - - 1 IPI00005487.1
246 IPI00005492.2 WD repeat protein 5 Nucl(SP) - - 3.20E-02 (TLPAHSDPVSAVHFNR;PNYALKFTLAGHTKAVSSVK) 3.41E-02 (MATEEKKPETEAAR;TLPAHSDPVSAVHFNR) - 1.09E-01 (TLPAHSDPVSAVHFNR;YCIFANFSVTGGK;TLIDDDNPPVSFVK;DGSLIVSSSYDGLCR) 1 IPI00005492.2
247 IPI00005573.3 Isoform 1 of 5'(3')-deoxyribonucleotidase, cytosolic type Cyto(SP,GO); Nucl(GO) - 3.82E-01 (VASVYEAPGFFLDLEPIPGALDAVR;DKTVVLGDLLIDDKDTVR;RFPEEPHVPLEQR;VLVDMDGVLADFEAGLLR;WVEQHLGPQFVER;ALRPDLADK;GQEETPSWEHILFTCCHNR) - - - - 1 IPI00005573.3
248 IPI00005614.6 Isoform Long of Spectrin beta chain, brain 1 PM(G1); Cyto(GO); Nucl(GO) 4.37E+00 (AELFTQSCADLDK;ALVADSHPESER;DALLSALSIQNYHLECNETK;DASVAEAWLLGQEPYLSSR;DGLNEAWADLLELIDTR;DLDDFQSWLSR;DLTSVNILLK;DQNTVETLQR;DVAEEIANYRPTLDTLHEQASALPQEHAESPDVR;DVEDEILWVGER;DVSSVELLMNNHQGIK;EAEKL 1.26E-01 (FQIQDISVETEDNK;FQIQDISVETEDNKEK;GNLEVLLFTIQSK;VHLENMGSHDIVDGNHR;HRPDLIDFDK;DALLSALSIQNYHLECNETK;DVAEEIANYRPTLDTLHEQASALPQEHAESPDVR;EIEELQSQAQALSQEGK;FANSLVGVQQQLQAFNTYR;FATDGEGYKPCDPQVIR;FLQ 1.04E-02 (EIEELQSQAQALSQEGK;SQNIVTDSSSLSAEAIR;HQILEQAVEDYAETVHQLSK;FQIQDISVETEDNKEKK) 1.11E-02 (SQNIVTDSSSLSAEAIR;MPLATSTDHGHNLQTVQLLIK;EIEELQSQAQALSQEGK;MHTTFEHDIQALGTQVR;DVSSVELLMNNHQGIK) 7.13E-03 (TQTAIASEDMPNTLTEAEK;KQEDFMTTMDANEEK;IVSSSDVGHDEYSTQSLVK) 1.15E+00 (DLTSVNILLK;GNLEVLLFTIQSK;FQIQDISVETEDNK;FQIQDISVETEDNKEK;AELFTQSCADLDK;DALLSALSIQNYHLECNETK;DGLNEAWADLLELIDTR;DVAEEIANYRPTLDTLHEQASALPQEHAESPDVR;EAEKLESEHPDQAQAILSR;EIEELQSQAQALSQEGK;FANSLVG 1 IPI00005614.6
249 IPI00005634.3 Tetratricopeptide repeat protein KIAA0372 Cyto(G2) - 1.09E-02 (FFENYNQSLEK;LVEMDSKSGPGLIGLGIK;RIDLYLALLSAVSASIKDEK;LLDLYESVDK) - - - - 1 IPI00005634.3
250 IPI00005661.1 Isoform Gamma of Max-like protein X Nucl(G1,SP,GO); Cyto(SP,GO) - - - - - 1.15E-01 (EIVIGVLHQLK;VEYAYSDNSLDPGLFVESTR) 2 IPI00005661.1, IPI00101383.5
251 IPI00005667.3 Nedd4 binding protein 1 Nucl(SP) - 1.05E-02 (FLLHLADK;EFSAGTVYPETNK) - - - 1.23E-01 (NKGVYSSTNELTTDSTPK;ESEVKREFK) 1 IPI00005667.3
252 IPI00005668.4 Aldo-keto reductase family 1 member C2 Cyto(G1); Nucl(G1) - 7.69E-01 (LLDFCK;RTPALIALR;GVVVLAKSYNEQR;TPALIALR;REDIFYTSK;DIVLVAYSALGSHR;LAIEAGFHHIDSAHVYNNEEQVGLAIR;LNDGHFMPVLGFGTYAPAEVPK;LWSNSHRPELVRPALER;NLQLDYVDLYLIHFPVSVK;NLQLDYVDLYLIHFPVSVKPGEEVIPK;NLQLDYVD - - - 2.30E-01 (TPALIALR;NLQLDYVDLYLIHFPVSVKPGEEVIPK;SKDIVLVAYSALGSHR;LAIEAGFHHIDSAHVYNNEEQVGLAIR;DIVLVAYSALGSHR) 1 IPI00005668.4
253 IPI00005677.1 Dihydroxyacetone phosphate acyltransferase Mito(G2) 7.98E-02 (AIQEHPVVLLPSHR;FGLLNIVMEPFFK;DVFADEFIFLPGNTLK;EVFDTYLVPISISYDK) - - 1.92E-02 (FGLLNIVMEPFFK;MESSSSSNSYFSVGPTSPSAVVLLYSK) - - 2 IPI00005677.1, IPI00640892.1
254 IPI00005682.2 Corticosteroid 11-beta-dehydrogenase isozyme 1 ER(SP,GO) 3.87E+00 (AVSGIVHMQAAPK;EECALEIIK;FALDGFFSSIR;ILEFLYSTSYNMDR;QEEVYYDSSLWTTLLIR) - - 1.15E+01 (AVSGIVHMQAAPK;FALDGFFSSIR;FALDGFFSSIRK;ILEFLYSTSYNMDR;KILEFLYSTSYNMDR;QEEVYYDSSLWTTLLIR;SMEVNFLSYVVLTVAALPMLK;VAYPMVAAYSASK;VAYPMVAAYSASKFALDGFFSSIR;MGAHVVVTAR;KSMEVNFLSYVVLTVAALPMLK) 1.64E+01 (AVSGIVHMQAAPK;FALDGFFSSIR;ILEFLYSTSYNMDR;KILEFLYSTSYNMDR;QEEVYYDSSLWTTLLIR;VAYPMVAAYSASK;VAYPMVAAYSASKFALDGFFSSIR;YLLPILGLFMAYYYYSANEEFRPEMLQGK;KSMEVNFLSYVVLTVAALPMLK;FALDGFFSSIRK;VAYPMVAAYS 4.33E-01 (FALDGFFSSIR;QEEVYYDSSLWTTLLIR;QSNGSIVVVSSLAGK) 1 IPI00005682.2
255 IPI00005690.2 Matrilin-3 precursor Cyto(G2) - 1.83E-02 (ARGAGVCKSR;HHCECSQGYTLNADK) - - - - 1 IPI00005690.2
256 IPI00005711.2 Histone deacetylase 6 Cyto(G1,SP); Nucl(SP,GO,HPA) - 1.72E-01 (GEMAATPAGFAQLTHLLMGLAGGK;LVLPIAYEFNPELVLVSAGFDAAR;PATEAELLTCHSAEYVGHLR;SAQASVSCALEALEPFWEVLVR;SLLGDPPPLLTLPRPPLSGALASITETIQVHR;VLADTYDSVYLHPNSYSCACLASGSVLR) - - - - 2 IPI00005711.2, IPI00647770.1
257 IPI00005715.5 Isoform 1 of Ubiquitin conjugation factor E4 B Cyto(G2); Nucl(G2) - 7.82E-03 (LAGGQTSQPTTPLTSPQR;FAKAIADDQR) - - - - 3 IPI00005715.5, IPI00555735.1, IPI00655534.2
258 IPI00005719.1 RAB1A, member RAS oncogene family ER(SP) - 6.59E-01 (IQLWDTAGQER;FADDTYTESYISTIGVDFK;EFADSLGIPFLETSAK;GAHGIIVVYDVTDQESFNNVK) - 6.99E-01 (IQIWDTAGQER;LLIIGDSGVGK;EFADSLGIPFLETSAK;NATNVEQSFMTMAAEIK;FADDTYTESYISTIGVDFK;GAHGIIVVYDVTDQESFNNVK) 5.70E-01 (IQIWDTAGQER;LLIIGDSGVGK;EFADSLGIPFLETSAK;NATNVEQSFMTMAAEIK;FADDTYTESYISTIGVDFK;GAHGIIVVYDVTDQESFNNVK) 7.41E-01 (IQLWDTAGQER;FADDTYTESYISTIGVDFK;EFADSLGIPFLETSAK;GAHGIIVVYDVTDQESFNNVK) 1 IPI00005719.1
259 IPI00005721.1 Neutrophil defensin 1 precursor PM(G1) 1.38E+00 (YGTCIYQGR;LWAFCC) - - - - - 2 IPI00005721.1, IPI00021827.3
260 IPI00005724.1 LanC-like protein 1 Cyto(SP,HPA); PM(GO); Nucl(SP) - 2.60E-02 (IPQSHIQQICETILTSGENLAR;SLAEGYFDAAGR) - 9.17E-02 (SLAEGYFDAAGR;AFPNPYADYNK) - - 1 IPI00005724.1
261 IPI00005728.2 RER1 protein PM(G2) - - - - 1.39E-01 (VDPSLMEDSDDGPSLPTK;LGQIYQSWLDK) - 3 IPI00005728.2, IPI00154352.2, IPI00647194.1
262 IPI00005737.1 Isoform 1 of Surfeit locus protein 4 ER(SP) - - - 5.44E-01 (NLALGGGLLLLLAESR;SMFAGVPTMR) 4.59E-01 (NLALGGGLLLLLAESR;SMFAGVPTMR) 5.94E-01 (LCLISTFLEDGIR;NLALGGGLLLLLAESR) 3 IPI00005737.1, IPI00399142.4, IPI00641719.1
263 IPI00005740.1 Neighbor of COX4 Cyto(G2,GO); Mito(GO,MitoP2); Nucl(GO) - - - 1.44E-01 (IAEGFSDTALIMVDNTK;ISASLLDSR;SYETLVDFDNHLDDIR) - - 1 IPI00005740.1
264 IPI00005750.1 Polycystic kidney disease and receptor for egg jelly-related protein precursor PM(G2) - 4.54E-03 (IILLSGFRTNK;LRLLGPGAAR) - - - - 1 IPI00005750.1
265 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit Cyto(G2,GO); Nucl(GO) - 1.59E-02 (QNPLLAEAYSNLGNVYK;LYLQMWEHYAAGNK;VAASQLTCLGCLELIAK) - - - - 2 IPI00005780.3, IPI00607723.1
266 IPI00005781.3 Isoform A of Arachidonate 15-lipoxygenase type II Nucl(G1) - - - - - 2.81E-02 (RSIATFQSRLAQISR;VSTGEAFGAGTWDK) 3 IPI00005781.3, IPI00220009.1, IPI00470667.1
267 IPI00005792.2 poly(A) binding protein, nuclear 1 Nucl(G1,GO,HPA); Cyto(SP,GO,HPA) - - - - - 3.26E-01 (GFAYIEFSDK;TSLALDESLFR) 2 IPI00005792.2, IPI00414963.2
268 IPI00005809.6 Serum deprivation-response protein Cyto(SP,GO,HPA); PM(HPA) - - - - 5.13E-02 (DNSQVNAVTVLTLLDK;VLIFQEENEIPASVFVK) - 1 IPI00005809.6
269 IPI00005811.3 Isoform 1 of DNA mismatch repair protein Mlh3 Nucl(G2) - 5.91E-03 (SSESLASK;QMNSSLR) - - - - 2 IPI00005811.3, IPI00218050.1
270 IPI00005826.1 HECT domain and RCC1-like domain-containing protein 2 Cyto(G2,SP); Nucl(SP) - 3.26E-03 (LEIFPDVLVHRLK;QRLVILERYFIALNR;WGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYR) - - - - 1 IPI00005826.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home